|
|
|
GRP (porcine)
Synonyms: porcine gastrin-releasing peptide 1-27 | pig gastrin-releasing peptide | grp (porcine)|gastrin releasing peptide, procine | apvsvgggtvlakmyprgnhwavghlm-nh2 | bombesin-27 | l-methioninamide,l-alanyl-l-prolyl-l-valyl-l-seryl-l-valylglycylglycylglycyl-l-threonyl-l-valyl-l-leucyl-l-alanyl-l-lysyl-l-methionyl-l-tyrosyl-l-prolyl-l-arginylglycyl-l-asparaginyl-l-histidyl-l-tryptophyl-l-alanyl-l-valylglycyl-l-histidyl-l-leucyl- | ala-pro-val-ser-val-gly-gly-gly-thr-val-leu-ala-lys-met-tyr-pro-arg-gly-asn-his-trp-ala-val-gly-his-leu-met-nh2 | porcine gastrin-releasing hormone | gastrin-releasing peptideã€pig】 | porcinegastrin-releasing heptacosapeptide | porcinegastrin-releasing peptide | porcine gastrin releasing peptide 27 | gastrin releasing peptide, porcine | gastrin-releasingpeptide (pig) | m.w. 2805.31 c126h198n38o31s2 | gastrin-releasing peptide (porcine) | grp (porcine) | gastrin-releasing peptide (guinea pig) | gastrin-releasingpeptide (swine) (9ci)
Formula: C126H198 N38 O31 S2
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for GRP (porcine). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We sell Ac-Gly-Pro-Leu-Asp-AMC as well. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
BOC Sciences
Company type: Supplier
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. Additionally is supplied by us. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. BOC Sciences is supplier for GRP (porcine). We hope to add immense value to your research projects!
Country: USA
Phone: +1-631-485-4226
Telefax: +1-631-614-7828
Hangzhou Dayangchem Co. Ltd.
Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. 4,4'-Dihydroxy diphenyl disulfide will be also provided by us. We act also as agent of many chemical factories and promote their products to the international market at very competitive price.
We take "Credi first, Clients supreme" as our aim. Hangzhou Dayangchem Co. Ltd. is supplier for GRP (porcine). We expect to cooperate with more partners ...
Country: P.R.China
Phone: +86-571-88938639
Telefax: +86-571-8893-8652
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. 5-Methyl-6-phenylthieno[2,3-d]pyrimidin-4-ol will be also provided by us. BuGuCh & Partners is supplier for GRP (porcine). Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Specification
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
2-(2-Methylbut-3-yn-2-yl)-5-(methylsulfonyl)isoindoline
Suppliers and manufactures - with identical CAS number as GRP (porcine)
For the following products supplier are listed below:
Gastrin Releasing Peptide, porcine
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We supply our chemical product 2-(9,9-Dihexyl-9H-fluoren-2-yl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find
new customers?
click here
Sino Life Industry Limi
Lifechemical was found in 1997,As be trustworthy and reliable supplier of chemicals, we specialized
Prakash Chemicals Inter
Prakash Chemicals International Pvt. Ltd. (PCIPL) today, stands as an archetype of unmatched qualit
Fan Avaran Shimi
We are the leading manufacturers of Metal Stearates in Iran (Calcium Stearate, Zinc Stearate, Magne
Anderson Development Co
Anderson Development Company is an award winning specialty and custom chemical manufacturer with a
H&Z Industry Co.,Ltd
H&Z Industry Co.,Ltd is a large reliable and professional manufacturer of chemical materials a
Allfluoro Pharmaceutica
Founded in 2015, Allfluoro pharmaceutical co. ltd. (AFPA) is a privately held, organic fluorine com
|
