|
|
|
GRF (porcine)
Synonyms: ghrf, porcine | grf (1-44) (porcine) | somatoliberin, porcine | grf (1-44), amide, porcine | growth hormone releasing factor porcine | growth hormone-releasing factor (1-44) (porcine) | yadaiftnsyrkvlgqlsarkllqdimsrqqgernqeqgarvrl-nh2 | growth hormone releasing factor (1-44), amide, porcine | somatocrinin (porcine), somatoliberin (porcine), growth hormone-releasing factor (porcine), ghrh (porcine), growth hormone-releasing hormone (porcine) | grf (porcine)
somatocrinin (porcine), somatoliberin (porcine), growth hormone-releasing factor (porcine), ghrh (porcine), growth hormone-releasing hormone (porcine) | somatoliberin(human pancreatic islet), 34-l-arginine-38-l-glutamine-42-l-valine- | somatoliberin(pig hypothalamus) | l-leucinamide, l-tyrosyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-asparaginyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-valyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-isoleucyl-l-methionyl-l-seryl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminylglycyl-l-alanyl-l-arginyl-l-valyl-l-arginyl- | somatoliberin (swinehypothalamus) (9ci)
Formula: C219H365 N73 O66 S
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. H-D-Glu(OBzl)-OBzl p-tosylate will be also provided by us. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for GRF (porcine). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as GRF (porcine)
For the following products supplier are listed below:
GRF (1-44) (porcine)
The following companies are not suppliers of GRF (porcine) . This companies are suppliers for equal products with the same CAS number. CAS: 88384-73-0
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We sell Benzene, 1-ethyl-4-methyl-2-(1-methylethyl)- as well.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find
new customers?
click here
Syntop Chemical Co Ltd
Syntop chemical Co.,Ltd. is a professional wax supplier from China .We have owned wax fact
Zhengzhou Key-chemi Bio
Zhengzhou Key-chemi biotechnology co., LTD. is a high-tech company committed to the field of chemic
Neelkanth Polymers
We ´NEELKANTH POLYMERS, INDIA´ are the leading Manufacturer & Exporter of Guar Gum Products fro
Jinan Wanxingda Chemica
Jinan Wanxingda chemical Co.,Ltd.was established in 2007 and is located in Jinan City, Shandong Pro
Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin
Xperio Impex
Xperio Impex is a global supplier of specialty & industrial chemicals based in New Delhi, India
|
